SCOPe 2.08: Domain d1swza_: 1swz A:

Lineage for d1swza_ (1swz A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d1swza_: 1swz A: [161734]
   automated match to d1swya_
   complexed with bme, cl, po4, rb

Details for d1swza_

PDB Entry: 1swz, 1.06 Å

PDB Description: use of an ion-binding site to bypass the 1000-atom limit to ab initio structure determination by direct methods

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1swza_:

Sequence; same for both SEQRES and ATOM records:

>d1swza_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvaaavrgilrnaklkpvydsldavrecalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d1swza_:

• d1swza_ first appeared in SCOPe 2.01
  
• d1swza_ appears in SCOPe 2.07