SCOPe 2.01: Domain d1spja_: 1spj A:

Lineage for d1spja_ (1spj A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries)

8. Domain d1spja_: 1spj A: [161733]
   automated match to d1sgfg_
   complexed with acy, ca, nag

Details for d1spja_

PDB Entry: 1spj, 1.7 Å

PDB Description: structure of mature human tissue kallikrein (human kallikrein 1 or klk1) at 1.70 angstrom resolution with vacant active site

PDB Compounds: (A:) Kallikrein 1

SCOPe Domain Sequences for d1spja_:

Sequence, based on SEQRES records:

>d1spja_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggweceqhsqpwqaalyhfstfqcggilvhrqwvltaahcisdnyqlwlgrhnlfdde
ntaqfvhvsesfphpgfnmsllenhtrqadedyshdlmllrltepadtitdavkvvelpt
eepevgstclasgwgsiepenfsfpddlqcvdlkilpndeckkahvqkvtdfmlcvghle
ggkdtcvgdsggplmcdgvlqgvtswgyvpcgtpnkpsvavrvlsyvkwiedtiaens

Sequence, based on observed residues (ATOM records):

>d1spja_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggweceqhsqpwqaalyhfstfqcggilvhrqwvltaahcisdnyqlwlgrhnlfdde
ntaqfvhvsesfphpgfnmsllenrqadedyshdlmllrltepadtitdavkvvelptee
pevgstclasgwgsiepenfsfpddlqcvdlkilpndeckkahvqkvtdfmlcvghlegg
kdtcvgdsggplmcdgvlqgvtswgyvpcgtpnkpsvavrvlsyvkwiedtiaens

Timeline for d1spja_:

• d1spja_ is new in SCOPe 2.01-stable
  
• d1spja_ appears in SCOPe 2.02
  
• d1spja_ appears in the current release, SCOPe 2.08