Lineage for d1spja_ (1spj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2796873Species Human (Homo sapiens) [TaxId:9606] [187233] (141 PDB entries)
  8. 2796895Domain d1spja_: 1spj A: [161733]
    automated match to d1sgfg_
    complexed with acy, ca, nag

Details for d1spja_

PDB Entry: 1spj (more details), 1.7 Å

PDB Description: structure of mature human tissue kallikrein (human kallikrein 1 or klk1) at 1.70 angstrom resolution with vacant active site
PDB Compounds: (A:) Kallikrein 1

SCOPe Domain Sequences for d1spja_:

Sequence, based on SEQRES records: (download)

>d1spja_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggweceqhsqpwqaalyhfstfqcggilvhrqwvltaahcisdnyqlwlgrhnlfdde
ntaqfvhvsesfphpgfnmsllenhtrqadedyshdlmllrltepadtitdavkvvelpt
eepevgstclasgwgsiepenfsfpddlqcvdlkilpndeckkahvqkvtdfmlcvghle
ggkdtcvgdsggplmcdgvlqgvtswgyvpcgtpnkpsvavrvlsyvkwiedtiaens

Sequence, based on observed residues (ATOM records): (download)

>d1spja_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggweceqhsqpwqaalyhfstfqcggilvhrqwvltaahcisdnyqlwlgrhnlfdde
ntaqfvhvsesfphpgfnmsllenrqadedyshdlmllrltepadtitdavkvvelptee
pevgstclasgwgsiepenfsfpddlqcvdlkilpndeckkahvqkvtdfmlcvghlegg
kdtcvgdsggplmcdgvlqgvtswgyvpcgtpnkpsvavrvlsyvkwiedtiaens

SCOPe Domain Coordinates for d1spja_:

Click to download the PDB-style file with coordinates for d1spja_.
(The format of our PDB-style files is described here.)

Timeline for d1spja_: