Lineage for d1sk1a_ (1sk1 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602103Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 1602116Protein automated matches [190780] (3 species)
    not a true protein
  7. 1602120Species Escherichia coli [TaxId:562] [188019] (7 PDB entries)
  8. 1602123Domain d1sk1a_: 1sk1 A: [161731]
    automated match to d1i9da_
    complexed with cs, so4; mutant

Details for d1sk1a_

PDB Entry: 1sk1 (more details), 1.55 Å

PDB Description: arsenate reductase r60k mutant +0.4m arsenate from e. coli
PDB Compounds: (A:) arsenate reductase

SCOPe Domain Sequences for d1sk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sk1a_ c.47.1.12 (A:) automated matches {Escherichia coli [TaxId: 562]}
nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallkkn
vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
aftkedgekvvdeagkrl

SCOPe Domain Coordinates for d1sk1a_:

Click to download the PDB-style file with coordinates for d1sk1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sk1a_: