| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.12: ArsC-like [69518] (4 proteins) Pfam PF03960 |
| Protein automated matches [190780] (4 species) not a true protein |
| Species Escherichia coli [TaxId:562] [188019] (7 PDB entries) |
| Domain d1sk0a_: 1sk0 A: [161730] automated match to d1i9da_ complexed with cs, so4, tas; mutant |
PDB Entry: 1sk0 (more details), 1.8 Å
SCOPe Domain Sequences for d1sk0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sk0a_ c.47.1.12 (A:) automated matches {Escherichia coli [TaxId: 562]}
nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallakn
vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
aftkedgekvvdeagkrl
Timeline for d1sk0a_: