Lineage for d1sjxa_ (1sjx A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105754Species Llama (Lama glama) [TaxId:9844] [187485] (23 PDB entries)
  8. 1105775Domain d1sjxa_: 1sjx A: [161728]
    automated match to d1ol0a_
    complexed with mpd

Details for d1sjxa_

PDB Entry: 1sjx (more details), 2.2 Å

PDB Description: Three-Dimensional Structure of a Llama VHH Domain OE7 binding the cell wall protein Malf1
PDB Compounds: (A:) immunoglobulin VH domain

SCOPe Domain Sequences for d1sjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjxa_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscqasgnifrindmgwyrqapgtqrelvaaitsggstkya
dsvkgrftiskdnakntvylqmnslkpedtavyycaaedrhrigtvgywgqgtqvtvss

SCOPe Domain Coordinates for d1sjxa_:

Click to download the PDB-style file with coordinates for d1sjxa_.
(The format of our PDB-style files is described here.)

Timeline for d1sjxa_: