SCOPe 2.08: Domain d1sjxa1: 1sjx A:806-919

Lineage for d1sjxa1 (1sjx A:806-919)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d1sjxa1: 1sjx A:806-919 [161728]
   Other proteins in same PDB: d1sjxa2
   automated match to d1ol0a_
   complexed with mpd

Details for d1sjxa1

PDB Entry: 1sjx, 2.2 Å

PDB Description: Three-Dimensional Structure of a Llama VHH Domain OE7 binding the cell wall protein Malf1

PDB Compounds: (A:) immunoglobulin VH domain

SCOPe Domain Sequences for d1sjxa1:

Sequence; same for both SEQRES and ATOM records:

>d1sjxa1 b.1.1.1 (A:806-919) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscqasgnifrindmgwyrqapgtqrelvaaitsggstkyadsvkg
rftiskdnakntvylqmnslkpedtavyycaaedrhrigtvgywgqgtqvtvss

Timeline for d1sjxa1:

• d1sjxa1 first appeared in SCOPe 2.01, called d1sjxa_
  
• d1sjxa1 appears in SCOPe 2.07