![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily) duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet |
![]() | Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) ![]() automatically mapped to Pfam PF02577 |
![]() | Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein) |
![]() | Protein Hypothetical protein TM0160 [103258] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [103259] (3 PDB entries) |
![]() | Domain d1sj5b1: 1sj5 B:1-141 [161721] Other proteins in same PDB: d1sj5a2, d1sj5b2 automated match to d1vjla_ |
PDB Entry: 1sj5 (more details), 2.8 Å
SCOPe Domain Sequences for d1sj5b1:
Sequence, based on SEQRES records: (download)
>d1sj5b1 d.257.1.1 (B:1-141) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]} mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthdl llsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiila vktgapifvsdnlvekhsiel
>d1sj5b1 d.257.1.1 (B:1-141) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]} mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthdl llsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktga pifvsdnlvekhsiel
Timeline for d1sj5b1: