SCOPe 2.07: Domain d1sj5b1: 1sj5 B:1-141

Lineage for d1sj5b1 (1sj5 B:1-141)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
   duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet

4. Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family)
   automatically mapped to Pfam PF02577

5. Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)

6. Protein Hypothetical protein TM0160 [103258] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [103259] (3 PDB entries)

8. Domain d1sj5b1: 1sj5 B:1-141 [161721]
   Other proteins in same PDB: d1sj5a2, d1sj5b2
   automated match to d1vjla_

Details for d1sj5b1

PDB Entry: 1sj5, 2.8 Å

PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 2.8 a resolution

PDB Compounds: (B:) conserved hypothetical protein TM0160

SCOPe Domain Sequences for d1sj5b1:

Sequence, based on SEQRES records:

>d1sj5b1 d.257.1.1 (B:1-141) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiila
vktgapifvsdnlvekhsiel

Sequence, based on observed residues (ATOM records):

>d1sj5b1 d.257.1.1 (B:1-141) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktga
pifvsdnlvekhsiel

Timeline for d1sj5b1:

• d1sj5b1 first appeared in SCOPe 2.01, called d1sj5b_
  
• d1sj5b1 appears in SCOPe 2.06
  
• d1sj5b1 appears in the current release, SCOPe 2.08