SCOPe 2.05: Domain d1sj5b_: 1sj5 B:

Lineage for d1sj5b_ (1sj5 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
   duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet

4. Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family)
   automatically mapped to Pfam PF02577

5. Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)

6. Protein Hypothetical protein TM0160 [103258] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [103259] (2 PDB entries)

8. Domain d1sj5b_: 1sj5 B: [161721]
   automated match to d1vjla_

Details for d1sj5b_

PDB Entry: 1sj5, 2.8 Å

PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 2.8 a resolution

PDB Compounds: (B:) conserved hypothetical protein TM0160

SCOPe Domain Sequences for d1sj5b_:

Sequence, based on SEQRES records:

>d1sj5b_ d.257.1.1 (B:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiil
avktgapifvsdnlvekhsiel

Sequence, based on observed residues (ATOM records):

>d1sj5b_ d.257.1.1 (B:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktg
apifvsdnlvekhsiel

Timeline for d1sj5b_:

• d1sj5b_ first appeared in SCOPe 2.01
  
• d1sj5b_ appears in SCOPe 2.04
  
• d1sj5b_ is called d1sj5b1 in SCOPe 2.06
  
• d1sj5b_ appears in the current release, SCOPe 2.08, called d1sj5b1