Lineage for d1sj5a1 (1sj5 A:1-150)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614857Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
    duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet
  4. 2614858Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) (S)
    automatically mapped to Pfam PF02577
  5. 2614859Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)
  6. 2614860Protein Hypothetical protein TM0160 [103258] (1 species)
  7. 2614861Species Thermotoga maritima [TaxId:2336] [103259] (3 PDB entries)
  8. 2614866Domain d1sj5a1: 1sj5 A:1-150 [161720]
    Other proteins in same PDB: d1sj5a2, d1sj5b2
    automated match to d1vjla_

Details for d1sj5a1

PDB Entry: 1sj5 (more details), 2.8 Å

PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 2.8 a resolution
PDB Compounds: (A:) conserved hypothetical protein TM0160

SCOPe Domain Sequences for d1sj5a1:

Sequence, based on SEQRES records: (download)

>d1sj5a1 d.257.1.1 (A:1-150) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiila
vktgapifvsdnlvekhsielevnerdlin

Sequence, based on observed residues (ATOM records): (download)

>d1sj5a1 d.257.1.1 (A:1-150) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapif
vsdnlvekhsielevnerdlin

SCOPe Domain Coordinates for d1sj5a1:

Click to download the PDB-style file with coordinates for d1sj5a1.
(The format of our PDB-style files is described here.)

Timeline for d1sj5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sj5a2