| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins) automatically mapped to Pfam PF00447 |
| Protein Heat-shock transcription factor [46874] (2 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46875] (2 PDB entries) |
| Domain d1hksa_: 1hks A: [16172] |
PDB Entry: 1hks (more details)
SCOPe Domain Sequences for d1hksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hksa_ a.4.5.22 (A:) Heat-shock transcription factor {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gsgvpaflaklwrlvddadtnrlicwtkdgqsfviqnqaqfakellplnykhnnmasfir
qlnmygfhkitsidngglrfdrdeiefshpffkrnspflldqikrk
Timeline for d1hksa_: