SCOPe 2.08: Domain d1hksa_: 1hks A:

Lineage for d1hksa_ (1hks A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
   automatically mapped to Pfam PF00447

6. Protein Heat-shock transcription factor [46874] (2 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46875] (2 PDB entries)

8. Domain d1hksa_: 1hks A: [16172]

Details for d1hksa_

PDB Entry: 1hks

PDB Description: solution structure of the dna-binding domain of drosophila heat shock transcription factor

PDB Compounds: (A:) heat-shock transcription factor

SCOPe Domain Sequences for d1hksa_:

Sequence; same for both SEQRES and ATOM records:

>d1hksa_ a.4.5.22 (A:) Heat-shock transcription factor {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gsgvpaflaklwrlvddadtnrlicwtkdgqsfviqnqaqfakellplnykhnnmasfir
qlnmygfhkitsidngglrfdrdeiefshpffkrnspflldqikrk

Timeline for d1hksa_:

• d1hksa_ first appeared (with stable ids) in SCOP 1.55, called d1hks__
  
• d1hksa_ appears in SCOPe 2.07