SCOPe 2.01: Domain d1sh7b_: 1sh7 B:

Lineage for d1sh7b_ (1sh7 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.0: automated matches [191390] (1 protein)
   not a true family

6. Protein automated matches [190500] (3 species)
   not a true protein

7. Species Vibrio sp. [TaxId:210249] [188018] (2 PDB entries)

8. Domain d1sh7b_: 1sh7 B: [161715]
   automated match to d1bjre_
   complexed with ca, pms

Details for d1sh7b_

PDB Entry: 1sh7, 1.84 Å

PDB Description: Crystal structure of a cold adapted subtilisin-like serine proteinase

PDB Compounds: (B:) extracellular subtilisin-like serine proteinase

SCOPe Domain Sequences for d1sh7b_:

Sequence; same for both SEQRES and ATOM records:

>d1sh7b_ c.41.1.0 (B:) automated matches {Vibrio sp. [TaxId: 210249]}
qsnaiwgldridqrnlpldrnynanfdgfgvtayvidtgvnnnheefggrsvsgydfvdn
dadssdcnghgthvagtiggsqygvaknvnivgvrvlscsgsgttsgvisgvdwvaqnas
gpsvanmslgggqstaldsavqgaiqsgvsfmlaagnsnadacntsparvpsgvtvgstt
ssdsrssfsnwgscvdlfapgsqiksawydggyktisgtsmatphvagvaalylqenngl
tplqltgllnsrasenkvsdtrgttnkllyslad

Timeline for d1sh7b_:

• d1sh7b_ is new in SCOPe 2.01-stable
  
• d1sh7b_ appears in SCOPe 2.02
  
• d1sh7b_ appears in the current release, SCOPe 2.08