Lineage for d1sh7a_ (1sh7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873828Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 2873829Protein automated matches [190500] (10 species)
    not a true protein
  7. 2873856Species Vibrio sp. [TaxId:210249] [188018] (2 PDB entries)
  8. 2873857Domain d1sh7a_: 1sh7 A: [161714]
    automated match to d1bjre_
    complexed with ca, pms

Details for d1sh7a_

PDB Entry: 1sh7 (more details), 1.84 Å

PDB Description: Crystal structure of a cold adapted subtilisin-like serine proteinase
PDB Compounds: (A:) extracellular subtilisin-like serine proteinase

SCOPe Domain Sequences for d1sh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sh7a_ c.41.1.0 (A:) automated matches {Vibrio sp. [TaxId: 210249]}
qsnaiwgldridqrnlpldrnynanfdgfgvtayvidtgvnnnheefggrsvsgydfvdn
dadssdcnghgthvagtiggsqygvaknvnivgvrvlscsgsgttsgvisgvdwvaqnas
gpsvanmslgggqstaldsavqgaiqsgvsfmlaagnsnadacntsparvpsgvtvgstt
ssdsrssfsnwgscvdlfapgsqiksawydggyktisgtsmatphvagvaalylqenngl
tplqltgllnsrasenkvsdtrgttnkllysladsgcepdc

SCOPe Domain Coordinates for d1sh7a_:

Click to download the PDB-style file with coordinates for d1sh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1sh7a_: