Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.12: ArsC-like [69518] (4 proteins) Pfam PF03960 |
Protein automated matches [190780] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [188019] (7 PDB entries) |
Domain d1sd9a_: 1sd9 A: [161711] automated match to d1i9da_ complexed with cs, so4; mutant |
PDB Entry: 1sd9 (more details), 1.65 Å
SCOPe Domain Sequences for d1sd9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sd9a_ c.47.1.12 (A:) automated matches {Escherichia coli [TaxId: 562]} nitiyhnpasgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallrkn vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg aftkedgekvvdeagkrl
Timeline for d1sd9a_: