Lineage for d1sd8a_ (1sd8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878345Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 2878358Protein automated matches [190780] (4 species)
    not a true protein
  7. 2878366Species Escherichia coli [TaxId:562] [188019] (7 PDB entries)
  8. 2878370Domain d1sd8a_: 1sd8 A: [161710]
    automated match to d1i9da_
    complexed with cs, so4; mutant

Details for d1sd8a_

PDB Entry: 1sd8 (more details), 1.59 Å

PDB Description: arsenate reductase r60k mutant from e. coli
PDB Compounds: (A:) arsenate reductase

SCOPe Domain Sequences for d1sd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sd8a_ c.47.1.12 (A:) automated matches {Escherichia coli [TaxId: 562]}
nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallkkn
vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
aftkedgekvvdeagkrl

SCOPe Domain Coordinates for d1sd8a_:

Click to download the PDB-style file with coordinates for d1sd8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sd8a_: