Lineage for d1duxf_ (1dux F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693426Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2693430Protein Elk-1 [46871] (1 species)
  7. 2693431Species Human (Homo sapiens) [TaxId:9606] [46872] (1 PDB entry)
  8. 2693433Domain d1duxf_: 1dux F: [16171]
    protein/DNA complex

Details for d1duxf_

PDB Entry: 1dux (more details), 2.1 Å

PDB Description: elk-1/dna structure reveals how residues distal from dna-binding surface affect dna-recognition
PDB Compounds: (F:) ets-domain protein elk-1

SCOPe Domain Sequences for d1duxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duxf_ a.4.5.21 (F:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]}
vtlwqfllqllreqgnghiiswtsrdggefklvdaeevarlwglrknktnmnydklsral
ryyydkniirkvsgqkfvykfvsype

SCOPe Domain Coordinates for d1duxf_:

Click to download the PDB-style file with coordinates for d1duxf_.
(The format of our PDB-style files is described here.)

Timeline for d1duxf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1duxc_