Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1saua_ (1sau A:)

  1. Root: SCOP 1.75B
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
    beta(3)-alpha(5); meander beta-sheet packed against array of helices
  4. Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) (S)
  5. Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 protein domains)
  6. Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (3 species)
  7. Species Archaeoglobus fulgidus [TaxId:224325] [187377] (2 PDB entries)
  8. Domain d1saua_: 1sau A: [161709]
    automated match to d1ji8a_

Details for d1saua_

PDB Entry: 1sau (more details)
PDB Description: the gamma subunit of the dissimilatory sulfite reductase (ds archaeoglobus fulgidus at 1.1 a resolution
PDB Compounds: (A:) sulfite reductase, desulfoviridin-type subunit gamma

SCOP Domain Sequences for d1saua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1saua_ d.203.1.1 (A:) DsrC, the gamma subunit of dissimilatory sulfite reductase {Archaeoglobus fulgidus [TaxId: 224325]}
pelevkgkklrldedgflqdweewdeevaealakdtrfspqpielteehwkiirylrdyf
ikygvappvrmlvkhckkevrpdcnlqyiyklfpqgpakdacriaglpkptgcv

SCOP Domain Coordinates for d1saua_:

Click to download the PDB-style file with coordinates for d1saua_.
(The format of our PDB-style files is described here.)

Timeline for d1saua_:

d1saua_ appears in SCOP 1.75A


d1saua_
(click for larger image)

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu