Lineage for d1s31a_ (1s31 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941172Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily)
    beta-sheet folds into a barrel (n=12, S=12) around the central helix
  4. 2941173Superfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families) (S)
  5. 2941174Family d.23.1.1: Transcriptional factor tubby, C-terminal domain [54519] (2 proteins)
    automatically mapped to Pfam PF01167
  6. 2941179Protein automated matches [190641] (1 species)
    not a true protein
  7. 2941180Species Human (Homo sapiens) [TaxId:9606] [187711] (3 PDB entries)
  8. 2941185Domain d1s31a_: 1s31 A: [161706]
    automated match to d1c8za_
    complexed with pge

Details for d1s31a_

PDB Entry: 1s31 (more details), 2.7 Å

PDB Description: crystal structure analysis of the human tub protein (isoform a) spanning residues 289 through 561
PDB Compounds: (A:) tubby isoform a

SCOPe Domain Sequences for d1s31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s31a_ d.23.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apsptapeqpvdvevqdleefalrpapqgitikcritrdkkgmdrgmfptyflhldredg
kkvfllagrkrkksktsnylisvdptdlsrggdsyigklrsnlmgtkftvydngvnpqka
ssstlesgtlrqelaavcyetnvlgfkgprkmsvivpgmnmvhervsirprnehetllar
wqnkntesiielqnktpvwnddtqsyvlnfhgrvtqasvknfqiihgndpdyivmqfgrv
aedvftmdynyplcalqafaialssfdsklace

SCOPe Domain Coordinates for d1s31a_:

Click to download the PDB-style file with coordinates for d1s31a_.
(The format of our PDB-style files is described here.)

Timeline for d1s31a_: