![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily) beta-sheet folds into a barrel (n=12, S=12) around the central helix |
![]() | Superfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families) ![]() |
![]() | Family d.23.1.1: Transcriptional factor tubby, C-terminal domain [54519] (2 proteins) automatically mapped to Pfam PF01167 |
![]() | Protein automated matches [190641] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187711] (3 PDB entries) |
![]() | Domain d1s31a_: 1s31 A: [161706] automated match to d1c8za_ complexed with pge |
PDB Entry: 1s31 (more details), 2.7 Å
SCOPe Domain Sequences for d1s31a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s31a_ d.23.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apsptapeqpvdvevqdleefalrpapqgitikcritrdkkgmdrgmfptyflhldredg kkvfllagrkrkksktsnylisvdptdlsrggdsyigklrsnlmgtkftvydngvnpqka ssstlesgtlrqelaavcyetnvlgfkgprkmsvivpgmnmvhervsirprnehetllar wqnkntesiielqnktpvwnddtqsyvlnfhgrvtqasvknfqiihgndpdyivmqfgrv aedvftmdynyplcalqafaialssfdsklace
Timeline for d1s31a_: