Lineage for d1s2nb_ (1s2n B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850575Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1850576Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1850914Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 1850915Protein automated matches [190500] (7 species)
    not a true protein
  7. 1850939Species Vibrio sp. [TaxId:210249] [188018] (2 PDB entries)
  8. 1850943Domain d1s2nb_: 1s2n B: [161705]
    automated match to d1bjre_
    complexed with ca, pms

Details for d1s2nb_

PDB Entry: 1s2n (more details), 2.44 Å

PDB Description: crystal structure of a cold adapted subtilisin-like serine proteinase
PDB Compounds: (B:) extracellular subtilisin-like serine proteinase

SCOPe Domain Sequences for d1s2nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2nb_ c.41.1.0 (B:) automated matches {Vibrio sp. [TaxId: 210249]}
snaiwgldridqrnlpldrnynanfdgfgvtayvidtgvnnnheefggrsvsgydfvdnd
adssdcnghgthvagtiggsqygvaknvnivgvrvlscsgsgttsgvisgvdwvaqnasg
psvanmslgggqstaldsavqgaiqsgvsfmlaagnsnadacntsparvpsgvtvgstts
sdsrssfsnwgscvdlfapgsqiksawydggyktisgtsmatphvagvaalylqennglt
plqltgllnsrasenkvsdtrgttnkllyslad

SCOPe Domain Coordinates for d1s2nb_:

Click to download the PDB-style file with coordinates for d1s2nb_.
(The format of our PDB-style files is described here.)

Timeline for d1s2nb_: