Lineage for d1rxsr_ (1rxs R:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125805Protein Uridine phosphorylase [53176] (6 species)
  7. 2125806Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)
  8. 2125884Domain d1rxsr_: 1rxs R: [161703]
    automated match to d1k3fa_
    complexed with dur, k, po4, v7o

Details for d1rxsr_

PDB Entry: 1rxs (more details), 2.8 Å

PDB Description: E. coli uridine phosphorylase: 2'-deoxyuridine phosphate complex
PDB Compounds: (R:) Uridine phosphorylase

SCOPe Domain Sequences for d1rxsr_:

Sequence, based on SEQRES records: (download)

>d1rxsr_ c.56.2.1 (R:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d1rxsr_ c.56.2.1 (R:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipmkqteshavkivve
aarrll

SCOPe Domain Coordinates for d1rxsr_:

Click to download the PDB-style file with coordinates for d1rxsr_.
(The format of our PDB-style files is described here.)

Timeline for d1rxsr_: