Lineage for d1bc7c_ (1bc7 C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438776Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 438805Protein Serum response factor accessory protein 1a, SAP-1 [46869] (1 species)
  7. 438806Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries)
  8. 438808Domain d1bc7c_: 1bc7 C: [16169]

Details for d1bc7c_

PDB Entry: 1bc7 (more details), 2.01 Å

PDB Description: serum response factor accessory protein 1a (sap-1)/dna complex

SCOP Domain Sequences for d1bc7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc7c_ a.4.5.21 (C:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens)}
mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls
ralryyyvkniikkvngqkfvykfvsypeilnm

SCOP Domain Coordinates for d1bc7c_:

Click to download the PDB-style file with coordinates for d1bc7c_.
(The format of our PDB-style files is described here.)

Timeline for d1bc7c_: