Lineage for d1qvnd_ (1qvn D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266371Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1266372Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1266458Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1266504Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 1266505Species Human (Homo sapiens) [TaxId:9606] [47302] (15 PDB entries)
  8. 1266524Domain d1qvnd_: 1qvn D: [161681]
    automated match to d1irla_
    complexed with fri, zn

Details for d1qvnd_

PDB Entry: 1qvn (more details), 2.7 Å

PDB Description: structure of sp4160 bound to il-2 v69a
PDB Compounds: (D:) interleukin-2

SCOPe Domain Sequences for d1qvnd_:

Sequence, based on SEQRES records: (download)

>d1qvnd_ a.26.1.2 (D:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
kpleealnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwit
fcqsiistl

Sequence, based on observed residues (ATOM records): (download)

>d1qvnd_ a.26.1.2 (D:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
kpleealnlaqrprdlisninvivlelkgsettfmceyadetativeflnrwitfcqsii
stl

SCOPe Domain Coordinates for d1qvnd_:

Click to download the PDB-style file with coordinates for d1qvnd_.
(The format of our PDB-style files is described here.)

Timeline for d1qvnd_: