Lineage for d1qvnb_ (1qvn B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992868Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1992926Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 1992927Species Human (Homo sapiens) [TaxId:9606] [47302] (16 PDB entries)
  8. 1992944Domain d1qvnb_: 1qvn B: [161679]
    automated match to d1irla_
    complexed with fri, zn

Details for d1qvnb_

PDB Entry: 1qvn (more details), 2.7 Å

PDB Description: structure of sp4160 bound to il-2 v69a
PDB Compounds: (B:) interleukin-2

SCOPe Domain Sequences for d1qvnb_:

Sequence, based on SEQRES records: (download)

>d1qvnb_ a.26.1.2 (B:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
kpleealnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwit
fcqsiistl

Sequence, based on observed residues (ATOM records): (download)

>d1qvnb_ a.26.1.2 (B:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
kpleealnlaqrprdlisninvivlelkgettfmceyadetativeflnrwitfcqsiis
tl

SCOPe Domain Coordinates for d1qvnb_:

Click to download the PDB-style file with coordinates for d1qvnb_.
(The format of our PDB-style files is described here.)

Timeline for d1qvnb_: