SCOPe 2.08: Domain d1qvna_: 1qvn A:

Lineage for d1qvna_ (1qvn A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-2 (IL-2) [47301] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47302] (20 PDB entries)

8. Domain d1qvna_: 1qvn A: [161678]
   automated match to d1irla_
   complexed with fri, zn

Details for d1qvna_

PDB Entry: 1qvn, 2.7 Å

PDB Description: structure of sp4160 bound to il-2 v69a

PDB Compounds: (A:) interleukin-2

SCOPe Domain Sequences for d1qvna_:

Sequence, based on SEQRES records:

>d1qvna_ a.26.1.2 (A:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
kpleealnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwit
fcqsiistl

Sequence, based on observed residues (ATOM records):

>d1qvna_ a.26.1.2 (A:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
kpleealnlaqrprdlisninvivlelkgsettfmceyadetativeflnrwitfcqsii
stl

Timeline for d1qvna_:

• d1qvna_ first appeared in SCOPe 2.01
  
• d1qvna_ appears in SCOPe 2.07