Lineage for d1pwod_ (1pwo D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733458Species Micropechis ikaheka [TaxId:66188] [188000] (1 PDB entry)
  8. 2733462Domain d1pwod_: 1pwo D: [161677]
    automated match to d1p7oa_

Details for d1pwod_

PDB Entry: 1pwo (more details), 2.6 Å

PDB Description: Crystal Structure of Phospholipase A2 (MIPLA2) from Micropechis Ikaheka
PDB Compounds: (D:) phospholipase a2

SCOPe Domain Sequences for d1pwod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwod_ a.133.1.2 (D:) automated matches {Micropechis ikaheka [TaxId: 66188]}
nlyqfrkmikctipgrepllaftdygcycgkggsgtpvdeldrccqthdncydkaeklpe
ckgilsgpyvntysydctdgkltcndqkdkcklficncdrtaamcfakapyieannhidp
nrck

SCOPe Domain Coordinates for d1pwod_:

Click to download the PDB-style file with coordinates for d1pwod_.
(The format of our PDB-style files is described here.)

Timeline for d1pwod_: