Lineage for d1awca_ (1awc A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) 
Family a.4.5.21: ets domain [46859] (6 proteins) 
Protein GA binding protein (GABP) alpha [46867] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [46868] (1 PDB entry) 
Domain d1awca_: 1awc A: [16167]
Other proteins in same PDB: d1awcb_
Details for d1awca_
PDB Entry: 1awc (more details), 2.15 Å
PDB Description: mouse gabp alpha/beta domain bound to dna
SCOP Domain Sequences for d1awca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus)}
iqlwqfllelltdkdardciswvgdegefklnqpelvaqkwgqrknkptmnyeklsralr
yyydgdmickvqgkrfvykfvcdlktligysaaelnrlvieceqkklarm
SCOP Domain Coordinates for d1awca_:
Click to download the PDB-style file with coordinates for d1awca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1awca_:
- d1awca_ appears in SCOP 1.57
- d1awca_ appears in the current release, SCOPe 2.08
View in 3D
