Lineage for d3ejdb_ (3ejd B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094812Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1094813Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1095254Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1095255Protein automated matches [190847] (18 species)
    not a true protein
  7. 1095258Species Bacillus subtilis [TaxId:1423] [188626] (3 PDB entries)
  8. 1095263Domain d3ejdb_: 3ejd B: [161666]
    Other proteins in same PDB: d3ejda1, d3ejdc1, d3ejde1, d3ejdg1
    automated match to d1jipa_
    complexed with cl, hem, htg, zmq

Details for d3ejdb_

PDB Entry: 3ejd (more details), 2.1 Å

PDB Description: crystal structure of p450bioi in complex with hexadec-9z-enoic acid ligated acyl carrier protein
PDB Compounds: (B:) Biotin biosynthesis cytochrome P450-like enzyme

SCOPe Domain Sequences for d3ejdb_:

Sequence, based on SEQRES records: (download)

>d3ejdb_ a.104.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
seflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpesstk
yqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgkkkm
evisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimavqam
ayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettvnlisnsvl
cllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvyll
lgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpsl
nladfewryrplfgfraleelpvtfe

Sequence, based on observed residues (ATOM records): (download)

>d3ejdb_ a.104.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
seflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpesstk
yqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgkkkm
evisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimavqam
ayfkeliqkrkrhpqqdmismllkgdklteeeaastcillaiaghettvnlisnsvlcll
qhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvylllga
anrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpslnla
dewryrplfgfraleelpvtfe

SCOPe Domain Coordinates for d3ejdb_:

Click to download the PDB-style file with coordinates for d3ejdb_.
(The format of our PDB-style files is described here.)

Timeline for d3ejdb_: