Lineage for d3ejbd_ (3ejb D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005545Species Bacillus subtilis [TaxId:1423] [188626] (6 PDB entries)
  8. 2005547Domain d3ejbd_: 3ejb D: [161663]
    Other proteins in same PDB: d3ejba2, d3ejba3, d3ejbc2, d3ejbc3, d3ejbe2, d3ejbe3, d3ejbg2, d3ejbg3
    automated match to d1jipa_
    complexed with cl, hem, htg, zmp

Details for d3ejbd_

PDB Entry: 3ejb (more details), 2 Å

PDB Description: crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein
PDB Compounds: (D:) Biotin biosynthesis cytochrome P450-like enzyme

SCOPe Domain Sequences for d3ejbd_:

Sequence, based on SEQRES records: (download)

>d3ejbd_ a.104.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
tasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpes
stkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgk
kkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimav
qamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettvnlisn
svlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqv
ylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrm
pslnladfewryrplfgfraleelpvtfe

Sequence, based on observed residues (ATOM records): (download)

>d3ejbd_ a.104.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
tasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpes
stkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgk
kkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimav
qamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettvnlisn
svlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqv
ylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrm
pslnlawryrplfgfraleelpvtfe

SCOPe Domain Coordinates for d3ejbd_:

Click to download the PDB-style file with coordinates for d3ejbd_.
(The format of our PDB-style files is described here.)

Timeline for d3ejbd_: