Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein automated matches [190134] (4 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [188613] (2 PDB entries) |
Domain d3ehba_: 3ehb A: [161661] Other proteins in same PDB: d3ehbb1, d3ehbb2, d3ehbc_, d3ehbd_ automated match to d1qlea_ complexed with ca, cu, hea, lda, lmt, mg, per; mutant |
PDB Entry: 3ehb (more details), 2.32 Å
SCOPe Domain Sequences for d3ehba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ehba_ f.24.1.1 (A:) automated matches {Paracoccus denitrificans [TaxId: 266]} gfftrwfmstnhkdigilylftagivglisvcftvymrmelqhpgvqymclegarliada saectpnghlwnvmityhgvlmmffvvipalfggfgnyfmplhigapdmafprldnlsyw myvcgvalgvasllapggndqmgsgvgwvlypplstteagysmdlaifavhvsgassilg ainiittflnmrapgmtlfkvplfawsvfitawlillslpvlagaitmllmdrnfgtqff dpagggdpvlyqhilwffghpevyiiilpgfgiishvistfakkpifgylpmvlamaaig ilgfvvwahhmytagmsltqqayfmlatmtiavptgikvfswiatmwggsiefktpmlwa fgflflftvggvtgvvlsqapldrvyhdtyyvvahfhyvmslgavfgifagvyywigkms grqypewagqlhfwmmfigsnliffpqhflgrqgmprryidypvefaywnnissigayis fasflffigivfytlfagkrvnvpnywnehadtlewtlpspppehtfetl
Timeline for d3ehba_:
View in 3D Domains from other chains: (mouse over for more information) d3ehbb1, d3ehbb2, d3ehbc_, d3ehbd_ |