Lineage for d3ehba_ (3ehb A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632417Protein automated matches [190134] (4 species)
    not a true protein
  7. 2632454Species Paracoccus denitrificans [TaxId:266] [188613] (2 PDB entries)
  8. 2632456Domain d3ehba_: 3ehb A: [161661]
    Other proteins in same PDB: d3ehbb1, d3ehbb2, d3ehbc_, d3ehbd_
    automated match to d1qlea_
    complexed with ca, cu, hea, lda, lmt, mg, per; mutant

Details for d3ehba_

PDB Entry: 3ehb (more details), 2.32 Å

PDB Description: a d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate
PDB Compounds: (A:) Cytochrome c oxidase subunit 1-beta

SCOPe Domain Sequences for d3ehba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ehba_ f.24.1.1 (A:) automated matches {Paracoccus denitrificans [TaxId: 266]}
gfftrwfmstnhkdigilylftagivglisvcftvymrmelqhpgvqymclegarliada
saectpnghlwnvmityhgvlmmffvvipalfggfgnyfmplhigapdmafprldnlsyw
myvcgvalgvasllapggndqmgsgvgwvlypplstteagysmdlaifavhvsgassilg
ainiittflnmrapgmtlfkvplfawsvfitawlillslpvlagaitmllmdrnfgtqff
dpagggdpvlyqhilwffghpevyiiilpgfgiishvistfakkpifgylpmvlamaaig
ilgfvvwahhmytagmsltqqayfmlatmtiavptgikvfswiatmwggsiefktpmlwa
fgflflftvggvtgvvlsqapldrvyhdtyyvvahfhyvmslgavfgifagvyywigkms
grqypewagqlhfwmmfigsnliffpqhflgrqgmprryidypvefaywnnissigayis
fasflffigivfytlfagkrvnvpnywnehadtlewtlpspppehtfetl

SCOPe Domain Coordinates for d3ehba_:

Click to download the PDB-style file with coordinates for d3ehba_.
(The format of our PDB-style files is described here.)

Timeline for d3ehba_: