SCOPe 2.01: Domain d3dogc_: 3dog C:

Lineage for d3dogc_ (3dog C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (204 PDB entries)
   Uniprot P24941

8. Domain d3dogc_: 3dog C: [161656]
   Other proteins in same PDB: d3dogb1, d3dogb2, d3dogd1, d3dogd2
   automated match to d1aq1a_
   complexed with nnn, sgm

Details for d3dogc_

PDB Entry: 3dog, 2.7 Å

PDB Description: Structure of Thr 160 phosphorylated CDK2/cyclin A in complex with the inhibitor N-&-N1

PDB Compounds: (C:) Cell division protein kinase 2

SCOPe Domain Sequences for d3dogc_:

Sequence, based on SEQRES records:

>d3dogc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records):

>d3dogc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtvppldedgrsllsqmlhy
dpnkrisakaalahpffqdvtkpvphlr

Timeline for d3dogc_:

• d3dogc_ is new in SCOPe 2.01-stable
  
• d3dogc_ appears in SCOPe 2.02
  
• d3dogc_ appears in the current release, SCOPe 2.08, called d3dogc1