Lineage for d3ddpa_ (3ddp A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1042555Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1042556Species Human (Homo sapiens) [TaxId:9606] [88856] (204 PDB entries)
    Uniprot P24941
  8. 1042788Domain d3ddpa_: 3ddp A: [161651]
    Other proteins in same PDB: d3ddpb1, d3ddpb2, d3ddpd1, d3ddpd2
    automated match to d1aq1a_
    complexed with rc8

Details for d3ddpa_

PDB Entry: 3ddp (more details), 2.7 Å

PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor CR8
PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d3ddpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ddpa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d3ddpa_:

Click to download the PDB-style file with coordinates for d3ddpa_.
(The format of our PDB-style files is described here.)

Timeline for d3ddpa_: