Lineage for d3dblk_ (3dbl K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538554Protein Nedd8 [54244] (1 species)
  7. 2538555Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
    Uniprot Q15843
  8. 2538571Domain d3dblk_: 3dbl K: [161648]
    Other proteins in same PDB: d3dbla_, d3dblb2, d3dblb3, d3dblc_, d3dbld2, d3dbld3, d3dble_, d3dblf2, d3dblf3, d3dblg_, d3dblh2, d3dblh3, d3dbli3
    automated match to d1nddb_
    complexed with zn

Details for d3dblk_

PDB Entry: 3dbl (more details), 2.9 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
PDB Compounds: (K:) nedd8

SCOPe Domain Sequences for d3dblk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dblk_ d.15.1.1 (K:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlqlrgg

SCOPe Domain Coordinates for d3dblk_:

Click to download the PDB-style file with coordinates for d3dblk_.
(The format of our PDB-style files is described here.)

Timeline for d3dblk_: