| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Nedd8 [54244] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries) Uniprot Q15843 |
| Domain d3dbhl_: 3dbh L: [161646] Other proteins in same PDB: d3dbha_, d3dbhb1, d3dbhb2, d3dbhc_, d3dbhd1, d3dbhd2, d3dbhe_, d3dbhf1, d3dbhf2, d3dbhg_, d3dbhh1, d3dbhh2, d3dbhi3 automated match to d1nddb_ complexed with zn |
PDB Entry: 3dbh (more details), 2.85 Å
SCOPe Domain Sequences for d3dbhl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbhl_ d.15.1.1 (L:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlrlrgg
Timeline for d3dbhl_: