Lineage for d3dbhk_ (3dbh K:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177392Protein Nedd8 [54244] (1 species)
  7. 2177393Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
    Uniprot Q15843
  8. 2177405Domain d3dbhk_: 3dbh K: [161645]
    Other proteins in same PDB: d3dbha_, d3dbhb1, d3dbhb2, d3dbhc_, d3dbhd1, d3dbhd2, d3dbhe_, d3dbhf1, d3dbhf2, d3dbhg_, d3dbhh1, d3dbhh2, d3dbhi3
    automated match to d1nddb_
    complexed with zn

Details for d3dbhk_

PDB Entry: 3dbh (more details), 2.85 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190ala-nedd8ala72arg)
PDB Compounds: (K:) nedd8

SCOPe Domain Sequences for d3dbhk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbhk_ d.15.1.1 (K:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlrlrgg

SCOPe Domain Coordinates for d3dbhk_:

Click to download the PDB-style file with coordinates for d3dbhk_.
(The format of our PDB-style files is described here.)

Timeline for d3dbhk_: