Lineage for d3dbhd_ (3dbh D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1188315Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 1188316Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 1188323Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 1188351Protein UBA3 [89764] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered)
  7. 1188352Species Human (Homo sapiens) [TaxId:9606] [89765] (8 PDB entries)
    Uniprot Q8TBC4 33-458
  8. 1188359Domain d3dbhd_: 3dbh D: [161641]
    Other proteins in same PDB: d3dbha_, d3dbhc_, d3dbhe_, d3dbhg_, d3dbhi_, d3dbhj_, d3dbhk_, d3dbhl_
    automated match to d1r4mb_
    complexed with zn

Details for d3dbhd_

PDB Entry: 3dbh (more details), 2.85 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190ala-nedd8ala72arg)
PDB Compounds: (D:) NEDD8-activating enzyme E1 catalytic subunit

SCOPe Domain Sequences for d3dbhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbhd_ c.111.1.2 (D:) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
ldwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlals
gfrqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdf
ndtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnaa
vilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpld
gddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfki
atsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltn
saslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvtt
pqtvlfklhfts

SCOPe Domain Coordinates for d3dbhd_:

Click to download the PDB-style file with coordinates for d3dbhd_.
(The format of our PDB-style files is described here.)

Timeline for d3dbhd_: