Lineage for d2stwa_ (2stw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983123Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 1983131Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 1983132Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries)
  8. 1983136Domain d2stwa_: 2stw A: [16164]
    protein/DNA complex

Details for d2stwa_

PDB Entry: 2stw (more details)

PDB Description: solution nmr structure of the human ets1/dna complex, restrained regularized mean structure
PDB Compounds: (A:) ets1

SCOPe Domain Sequences for d2stwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2stwa_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv

SCOPe Domain Coordinates for d2stwa_:

Click to download the PDB-style file with coordinates for d2stwa_.
(The format of our PDB-style files is described here.)

Timeline for d2stwa_: