Lineage for d3d7wa_ (3d7w A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047397Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1047398Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1047399Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1047532Protein automated matches [190420] (8 species)
    not a true protein
  7. 1047542Species European mistletoe (Viscum album) [TaxId:3972] [188629] (3 PDB entries)
  8. 1047544Domain d3d7wa_: 3d7w A: [161639]
    Other proteins in same PDB: d3d7wb1, d3d7wb2
    automated match to d1m2ta_
    complexed with gol, nag, so4, zea, zez

Details for d3d7wa_

PDB Entry: 3d7w (more details), 2.49 Å

PDB Description: mistletoe lectin i in complex with zeatin
PDB Compounds: (A:) Beta-galactoside-specific lectin 1

SCOPe Domain Sequences for d3d7wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d7wa_ d.165.1.1 (A:) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
yerlrlrtdqqttgeeyfsfitllrdyvssgsfsnnipllrqstvpvsegqrfvlveltn
aggdtitaaidvtnlyvvayeagnqsyflsdapagaetqdfsgttsssqpfngsypdler
yaghrdqiplgidqliqsvtalrfpggqtktqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpialaiapgvivtltnirdviasl
aimlfvcge

SCOPe Domain Coordinates for d3d7wa_:

Click to download the PDB-style file with coordinates for d3d7wa_.
(The format of our PDB-style files is described here.)

Timeline for d3d7wa_: