![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein automated matches [190888] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188282] (9 PDB entries) |
![]() | Domain d3d1md_: 3d1m D: [161637] Other proteins in same PDB: d3d1ma_, d3d1mb_ automated match to d1x4ya1 complexed with ca, zn |
PDB Entry: 3d1m (more details), 1.7 Å
SCOPe Domain Sequences for d3d1md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d1md_ b.1.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pitgphiayteavsdtqimlkwtyipssnnntpiqgfyiyyrptdsdndsdykrdvvegs kqwhmighlqpetsydikmqcfneggesefsnvmicetk
Timeline for d3d1md_: