Lineage for d2stta_ (2stt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306859Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2306867Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 2306868Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries)
  8. 2306871Domain d2stta_: 2stt A: [16163]
    protein/DNA complex

Details for d2stta_

PDB Entry: 2stt (more details)

PDB Description: solution nmr structure of the human ets1/dna complex, 25 structures
PDB Compounds: (A:) ets1

SCOPe Domain Sequences for d2stta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2stta_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv

SCOPe Domain Coordinates for d2stta_:

Click to download the PDB-style file with coordinates for d2stta_.
(The format of our PDB-style files is described here.)

Timeline for d2stta_: