| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.98: BLIP-like [55647] (2 superfamilies) alpha(2)-beta(4); 2 layers: alpha/beta |
Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) ![]() |
| Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins) duplication: consists of two clear structural repeats each having this fold automatically mapped to Pfam PF07467 |
| Protein automated matches [190210] (1 species) not a true protein |
| Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries) |
| Domain d3c7vd_: 3c7v D: [161627] Other proteins in same PDB: d3c7va_, d3c7vc_ automated match to d1jtgb_ |
PDB Entry: 3c7v (more details), 2.07 Å
SCOPe Domain Sequences for d3c7vd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c7vd_ d.98.1.1 (D:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyaayatfgfts
aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgfyrgsahlwftdgvlqgkrqwdlv
Timeline for d3c7vd_: