![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.98: BLIP-like [55647] (2 superfamilies) alpha(2)-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) ![]() |
![]() | Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins) duplication: consists of two clear structural repeats each having this fold |
![]() | Protein automated matches [190210] (1 species) not a true protein |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries) |
![]() | Domain d3c7ud_: 3c7u D: [161625] Other proteins in same PDB: d3c7ua_, d3c7uc_ automated match to d1jtgb_ |
PDB Entry: 3c7u (more details), 2.2 Å
SCOPe Domain Sequences for d3c7ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c7ud_ d.98.1.1 (D:) automated matches {Streptomyces clavuligerus [TaxId: 1901]} agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp stagvtlslscfdvdgysstgfyrgsahlaftdgvlqgkrqwdlv
Timeline for d3c7ud_: