Lineage for d3c7ub_ (3c7u B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1036421Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 1036422Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) (S)
  5. 1036423Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 1036430Protein automated matches [190210] (1 species)
    not a true protein
  7. 1036431Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries)
  8. 1036448Domain d3c7ub_: 3c7u B: [161624]
    Other proteins in same PDB: d3c7ua_, d3c7uc_
    automated match to d1jtgb_

Details for d3c7ub_

PDB Entry: 3c7u (more details), 2.2 Å

PDB Description: Structural Insight into the Kinetics and Cp of interactions between TEM-1-Lactamase and BLIP
PDB Compounds: (B:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d3c7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7ub_ d.98.1.1 (B:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgfyrgsahlaftdgvlqgkrqwdlv

SCOPe Domain Coordinates for d3c7ub_:

Click to download the PDB-style file with coordinates for d3c7ub_.
(The format of our PDB-style files is described here.)

Timeline for d3c7ub_: