Lineage for d3c4pb_ (3c4p B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1036421Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 1036422Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) (S)
  5. 1036423Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 1036430Protein automated matches [190210] (1 species)
    not a true protein
  7. 1036431Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries)
  8. 1036437Domain d3c4pb_: 3c4p B: [161623]
    Other proteins in same PDB: d3c4pa_
    automated match to d1jtgb_
    complexed with so4

Details for d3c4pb_

PDB Entry: 3c4p (more details), 1.75 Å

PDB Description: crystal structure of the shv-1 beta-lactamase/beta-lactamase inhibitor protein (blip) e73m complex
PDB Compounds: (B:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d3c4pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c4pb_ d.98.1.1 (B:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqmkllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgfyrgsahlwftdgvlqgkrqwdlv

SCOPe Domain Coordinates for d3c4pb_:

Click to download the PDB-style file with coordinates for d3c4pb_.
(The format of our PDB-style files is described here.)

Timeline for d3c4pb_: