Lineage for d3c4ob_ (3c4o B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573754Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 2573755Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) (S)
  5. 2573756Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
    automatically mapped to Pfam PF07467
  6. 2573763Protein automated matches [190210] (1 species)
    not a true protein
  7. 2573764Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries)
  8. 2573772Domain d3c4ob_: 3c4o B: [161622]
    Other proteins in same PDB: d3c4oa_
    automated match to d1jtgb_
    complexed with so4

Details for d3c4ob_

PDB Entry: 3c4o (more details), 1.7 Å

PDB Description: crystal structure of the shv-1 beta-lactamase/beta-lactamase inhibitor protein (blip) e73m/s130k/s146m complex
PDB Compounds: (B:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d3c4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c4ob_ d.98.1.1 (B:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqmkllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslkcfdvdgysstgfyrgmahlwftdgvlqgkrqwdlv

SCOPe Domain Coordinates for d3c4ob_:

Click to download the PDB-style file with coordinates for d3c4ob_.
(The format of our PDB-style files is described here.)

Timeline for d3c4ob_: