Lineage for d1etc__ (1etc -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 278056Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 278061Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 278065Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries)
  8. 278076Domain d1etc__: 1etc - [16162]

Details for d1etc__

PDB Entry: 1etc (more details)

PDB Description: solution structure of the ets domain from murine ets-1: a winged helix-turn-helix dna binding motif

SCOP Domain Sequences for d1etc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etc__ a.4.5.21 (-) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad

SCOP Domain Coordinates for d1etc__:

Click to download the PDB-style file with coordinates for d1etc__.
(The format of our PDB-style files is described here.)

Timeline for d1etc__: