| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Yellow perch (Perca flavescens) [TaxId:8167] [188574] (3 PDB entries) |
| Domain d3bj2a_: 3bj2 A: [161616] Other proteins in same PDB: d3bj2b_, d3bj2d_ automated match to d1xq5a_ complexed with ace, hem |
PDB Entry: 3bj2 (more details), 2 Å
SCOPe Domain Sequences for d3bj2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bj2a_ a.1.1.2 (A:) automated matches {Yellow perch (Perca flavescens) [TaxId: 8167]}
slsskdkdavkalwgkiadkaeeigadalgrmlavypqtktyfshwkdlspgsapvnkhg
ktimgglvdavasiddlnagllalselhaftlrvdpanfkilshcilvqlavkfpkdftp
evhlsydkffsavaralaekyr
Timeline for d3bj2a_: