Lineage for d3bj1a_ (3bj1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688842Species Yellow perch (Perca flavescens) [TaxId:8167] [188574] (3 PDB entries)
  8. 2688843Domain d3bj1a_: 3bj1 A: [161614]
    Other proteins in same PDB: d3bj1b_, d3bj1d_
    automated match to d1xq5a_
    complexed with ace, hem

Details for d3bj1a_

PDB Entry: 3bj1 (more details), 1.9 Å

PDB Description: met-Perch Hemoglobin at pH 5.7
PDB Compounds: (A:) hemoglobin alpha

SCOPe Domain Sequences for d3bj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bj1a_ a.1.1.2 (A:) automated matches {Yellow perch (Perca flavescens) [TaxId: 8167]}
slsskdkdavkalwgkiadkaeeigadalgrmlavypqtktyfshwkdlspgsapvnkhg
ktimgglvdavasiddlnagllalselhaftlrvdpanfkilshcilvqlavkfpkdftp
evhlsydkffsavaralaekyr

SCOPe Domain Coordinates for d3bj1a_:

Click to download the PDB-style file with coordinates for d3bj1a_.
(The format of our PDB-style files is described here.)

Timeline for d3bj1a_: