Lineage for d1etd__ (1etd -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150274Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 150279Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 150283Species Mouse (Mus musculus) [TaxId:10090] [46863] (5 PDB entries)
  8. 150290Domain d1etd__: 1etd - [16161]

Details for d1etd__

PDB Entry: 1etd (more details)

PDB Description: solution structure of the ets domain from murine ets-1: a winged helix-turn-helix dna binding motif

SCOP Domain Sequences for d1etd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etd__ a.4.5.21 (-) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad

SCOP Domain Coordinates for d1etd__:

Click to download the PDB-style file with coordinates for d1etd__.
(The format of our PDB-style files is described here.)

Timeline for d1etd__: