Lineage for d3b3qb_ (3b3q B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136415Species Mouse (Mus musculus) [TaxId:10090] [188313] (1 PDB entry)
  8. 2136417Domain d3b3qb_: 3b3q B: [161603]
    Other proteins in same PDB: d3b3qe2, d3b3qe3, d3b3qf2, d3b3qf3
    automated match to d1j06b_
    complexed with ca, nag

Details for d3b3qb_

PDB Entry: 3b3q (more details), 2.4 Å

PDB Description: Crystal structure of a synaptic adhesion complex
PDB Compounds: (B:) Nlgn1 protein

SCOPe Domain Sequences for d3b3qb_:

Sequence, based on SEQRES records: (download)

>d3b3qb_ c.69.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dplvttnfgkirgikkelnneilgpviqflgvpyaapptgehrfqppeppspwsdirnat
qfapvcpqniidgrlpevmlpvwftnnldvvssyvqdqsedclylniyvpteddirdsgg
pkpvmvyihggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgdqaakgnygl
ldliqalrwtsenigffggdplritvfgsgaggscvnlltlshyseglfqraiaqsgtal
sswavsfqpakyarilatkvgcqvsdtvelveclqkkpykelvdqdvqparyhiafgpvi
dgdvipddpqilmeqgeflnydimlgvnqgeglkfvenivdsddgvsasdfdfavsnfvd
nlygypegkdvlretikfmytdwadrhnpetrrktllalftdhqwvapavatadlhsnfg
sptyfyafyhhcqtdqvpawadaahgdevpyvlgipmigptelfpcnfskndvmlsavvm
tywtnfaktgdpnqpvpqdtkfihtkpnrfeevawtrysqkdqlylhiglkprvkehyra
nkvnlwlelvphlhn

Sequence, based on observed residues (ATOM records): (download)

>d3b3qb_ c.69.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dplvttnfgkirgikkelnneilgpviqflgvpyaapptgehrfqppeppspwsdirnat
qfapvcpqniidgrlpevmlpvwftnnldvvssyvqdqsedclylniyvptedggpkpvm
vyihggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgdqaakgnyglldliq
alrwtsenigffggdplritvfgsgaggscvnlltlshyseglfqraiaqsgtalsswav
sfqpakyarilatkvgcqvsdtvelveclqkkpykelvdqdvqparyhiafgpvidgdvi
pddpqilmeqgeflnydimlgvnqgeglkfvenivdsddgvsasdfdfavsnfvdnlygy
dvlretikfmytdwadrhnpetrrktllalftdhqwvapavatadlhsnfgsptyfyafy
hhcqtdqvpawadaahgdevpyvlgipmigptelfpcnfskndvmlsavvmtywtnfakt
gdpnqpvpqdfeevawtrysqkdqlylhiglkprvkehyrankvnlwlelvphlhn

SCOPe Domain Coordinates for d3b3qb_:

Click to download the PDB-style file with coordinates for d3b3qb_.
(The format of our PDB-style files is described here.)

Timeline for d3b3qb_: