SCOPe 2.05: Domain d1flia_: 1fli A:

Lineage for d1flia_ (1fli A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein Fli-1 [46860] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46861] (1 PDB entry)

8. Domain d1flia_: 1fli A: [16160]

Details for d1flia_

PDB Entry: 1fli

PDB Description: dna-binding domain of fli-1

PDB Compounds: (A:) fli-1

SCOPe Domain Sequences for d1flia_:

Sequence; same for both SEQRES and ATOM records:

>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]}
pgsgqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydkl
sralryyydknimtkvhgkryaykfdfhgiaqalqphp

Timeline for d1flia_:

• d1flia_ first appeared (with stable ids) in SCOP 1.55
  
• d1flia_ appears in SCOPe 2.04
  
• d1flia_ appears in SCOPe 2.06
  
• d1flia_ appears in the current release, SCOPe 2.08